PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr005472.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 605aa    MW: 66618.7 Da    PI: 5.0147
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr005472.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.51.2e-1102356042374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   ++LlecA+ ++++d   a + L rl+e +s +gdp++R+a+yf+eAL++r++    +l k++++  +++   ++ + ++k++++++P+ kf+hltaN
  Pbr005472.1 235 LKALLECAR-IAESDPDGAVKSLVRLRESVSDHGDPTERVAFYFAEALQNRVSF--LQLEKSFTTAYDTP--CEDFTLSYKALNDACPYSKFAHLTAN 327
                  689*****9.78889*************************************98..77888776666664..99999********************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  qaIlea+e+++++Hi+Df+i qG+QW+aLlqaLa+R+ g+p s+Ri g+ +p+ g   + +l +tg+rL++fA+ l+++fef++ + + +++l+ +  
  Pbr005472.1 328 QAILEATERATKIHIVDFGIVQGVQWAALLQALATRSTGKPvSIRISGIPAPSLGdsPAASLIATGNRLREFAKLLELNFEFEP-ILTPVHQLDESCV 424
                  *************************************77777**********999889999***********************.799********** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  rv+p+EalaVnlvlql++llde+ +  +   + Lkl ksl+P+vv++ e ea++n+  F+ rf +al+yy+alf+sle ++ r+s er kvEr llgr
  Pbr005472.1 425 RVDPDEALAVNLVLQLYNLLDEKPTAVQ---SALKLAKSLNPQVVTLGEYEANLNRVGFASRFKNALKYYAALFESLEPNMIRDSPERLKVERLLLGR 519
                  ********************99999988...9****************************************************************** PP

         GRAS 293 eivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                  +i ++v  e+   +rer e +e+W+  +e +GF+pv+ls++ ++qak ll +++ s  y++ e+   ++ l W++ pL++vS+Wr
  Pbr005472.1 520 RIGSLVGPEQPGtKRERFEDKEQWKYLMECSGFEPVALSHYSVSQAKILLWNYNySSLYSLRESPPGFLsLSWNEVPLFTVSSWR 604
                  ********998769****************************************9999****99877777**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.084208582IPR005202Transcription factor GRAS
PfamPF035144.2E-108235604IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QKQQQEQQQQ QRHHHHQPPL GAFSLTPWPN NNHHTLTQSP  60
NLGFGLTGSG FSDPFQLPGS SDAGGEPGFP FPNLDHHSAG FRFSDLGGGG PAEFDSDEWM  120
DSIIGGGDST DSSNLPSACD TWQGSNSDFG LYGADPFRPH CPSRLSNPCS PPSDLNRVIF  180
SETQNQLPAW TSPLPQQLHQ VSVKESKSTD PQSLPNDAVG VSLRSPEIES EPPLLKALLE  240
CARIAESDPD GAVKSLVRLR ESVSDHGDPT ERVAFYFAEA LQNRVSFLQL EKSFTTAYDT  300
PCEDFTLSYK ALNDACPYSK FAHLTANQAI LEATERATKI HIVDFGIVQG VQWAALLQAL  360
ATRSTGKPVS IRISGIPAPS LGDSPAASLI ATGNRLREFA KLLELNFEFE PILTPVHQLD  420
ESCVRVDPDE ALAVNLVLQL YNLLDEKPTA VQSALKLAKS LNPQVVTLGE YEANLNRVGF  480
ASRFKNALKY YAALFESLEP NMIRDSPERL KVERLLLGRR IGSLVGPEQP GTKRERFEDK  540
EQWKYLMECS GFEPVALSHY SVSQAKILLW NYNYSSLYSL RESPPGFLSL SWNEVPLFTV  600
SSWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1492336043375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009350005.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLM5VW270.0M5VW27_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s12520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62803449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein